PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G26730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 426aa    MW: 47914.2 Da    PI: 9.7634
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G26730.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.36.6e-24151195145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCs+++++++k+CErH++r+r+rsrk++e+
  OPUNC03G26730.1 151 DPEPGRCRRTDGKKWRCSKEAMADHKYCERHINRNRHRSRKPVEN 195
                      79****************************************997 PP

2QLQ57.25e-2092127237
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      +FT++Q+++L++Q+l+yKyL+a++P+P+ Ll  i+k
  OPUNC03G26730.1  92 PFTPSQWMELEHQALIYKYLNAKAPIPSSLLISISK 127
                      9******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.6E-1191127IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.6E-1492125IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.76292127IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.803151195IPR014977WRC domain
PfamPF088793.7E-20152194IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MFADFSAAAM ELGEVLGLQG LTVPSTKEGD LSLIKRAAAG SFTQAAAASY PSPFLDEQKM  60
LRFAKAAHTL PSGLDFVREN EQRFLLSRTK RPFTPSQWME LEHQALIYKY LNAKAPIPSS  120
LLISISKSFR SSANRMSWRP LYQGFPNADS DPEPGRCRRT DGKKWRCSKE AMADHKYCER  180
HINRNRHRSR KPVENQSRKT VKETPCAGSL PSSVGQGNFK KAKVNEMQPS SISYWTDSLN  240
RTMANKEKGN KAAEENNAPL LNLKNQQPTL SLFSQLKQPN KPEKFRPAGD CESISSNTML  300
KPWESSNQQN NKNIPFTKMH DRGCLQSVLQ NFSLPKDEKM EFQKNKDSNV ITVPSTFYSS  360
PDGPRVSCHT PNMAQMQEDS ISSSWEMPQG GPLGEILTNS KNTDDSIMKP EARPYGWLLN  420
LEDHAM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0586590.0AK058659.1 Oryza sativa Japonica Group cDNA clone:001-018-F11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627920.10.0PREDICTED: growth-regulating factor 9
SwissprotQ9FRG80.0GRF9_ORYSJ; Growth-regulating factor 9
TrEMBLA0A0E0KHC60.0A0A0E0KHC6_ORYPU; Uncharacterized protein
STRINGLOC_Os03g47140.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131242529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.13e-34growth-regulating factor 1